Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (12 species) not a true protein |
Species Bacillus halodurans [TaxId:272558] [270836] (1 PDB entry) |
Domain d4xjcd_: 4xjc D: [270842] automated match to d2qxxa_ complexed with mg, peg, ttp |
PDB Entry: 4xjc (more details), 2.35 Å
SCOPe Domain Sequences for d4xjcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xjcd_ b.85.4.0 (D:) automated matches {Bacillus halodurans [TaxId: 272558]} milsgktisekltekeleitplteeqiqpasvdlrlgphfvtiddskeavisferpiryr ewttsdetivlpphtfllattmetvklpnhltafvegrssvgrlglfiqnagwvdpgfng qitlelfnanrlpielpigrricqlvfaevtgevapyqgkylfqkgatmseiykdaf
Timeline for d4xjcd_: