Lineage for d1aqb__ (1aqb -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16457Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins)
  6. 16560Protein Retinol binding protein [50816] (4 species)
  7. 16577Species Pig (Sus scrofa domestica) [TaxId:9823] [50818] (1 PDB entry)
  8. 16578Domain d1aqb__: 1aqb - [27084]

Details for d1aqb__

PDB Entry: 1aqb (more details), 1.65 Å

PDB Description: retinol-binding protein (rbp) from pig plasma

SCOP Domain Sequences for d1aqb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqb__ b.60.1.1 (-) Retinol binding protein {Pig (Sus scrofa domestica)}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdenghmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdydtyavqysc
rlqnldgtcadsysfvfardphgfspevqkivrqrqeelclarqyriithngycd

SCOP Domain Coordinates for d1aqb__:

Click to download the PDB-style file with coordinates for d1aqb__.
(The format of our PDB-style files is described here.)

Timeline for d1aqb__: