Lineage for d1aqba_ (1aqb A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804714Protein Retinol binding protein [50816] (5 species)
  7. 2804752Species Pig (Sus scrofa) [TaxId:9823] [50818] (1 PDB entry)
  8. 2804753Domain d1aqba_: 1aqb A: [27084]
    complexed with cd, rtl

Details for d1aqba_

PDB Entry: 1aqb (more details), 1.65 Å

PDB Description: retinol-binding protein (rbp) from pig plasma
PDB Compounds: (A:) retinol-binding protein

SCOPe Domain Sequences for d1aqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqba_ b.60.1.1 (A:) Retinol binding protein {Pig (Sus scrofa) [TaxId: 9823]}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdenghmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdydtyavqysc
rlqnldgtcadsysfvfardphgfspevqkivrqrqeelclarqyriithngycd

SCOPe Domain Coordinates for d1aqba_:

Click to download the PDB-style file with coordinates for d1aqba_.
(The format of our PDB-style files is described here.)

Timeline for d1aqba_: