SCOPe 2.05: Domain d4xjcb_: 4xjc B:

Lineage for d4xjcb_ (4xjc B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (12 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [270836] (1 PDB entry)

8. Domain d4xjcb_: 4xjc B: [270838]
   automated match to d2qxxa_
   complexed with mg, peg, ttp

Details for d4xjcb_

PDB Entry: 4xjc, 2.35 Å

PDB Description: dctp deaminase-dutpase from bacillus halodurans

PDB Compounds: (B:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d4xjcb_:

Sequence; same for both SEQRES and ATOM records:

>d4xjcb_ b.85.4.0 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
milsgktisekltekeleitplteeqiqpasvdlrlgphfvtiddskeavisferpiryr
ewttsdetivlpphtfllattmetvklpnhltafvegrssvgrlglfiqnagwvdpgfng
qitlelfnanrlpielpigrricqlvfaevtgevapyqgkylfqkgatmseiykdaf

Timeline for d4xjcb_:

• d4xjcb_ is new in SCOPe 2.05-stable
  
• d4xjcb_ appears in SCOPe 2.06
  
• d4xjcb_ appears in the current release, SCOPe 2.08