Lineage for d1fema_ (1fem A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2062523Family b.60.1.1: Retinol binding protein-like [50815] (22 protein domains)
    barrel, closed; n=8, S=12, meander
  6. 2062918Protein Retinol binding protein [50816] (5 species)
  7. 2062924Species Cow (Bos taurus) [TaxId:9913] [50817] (11 PDB entries)
  8. 2062935Domain d1fema_: 1fem A: [27083]
    complexed with rea

Details for d1fema_

PDB Entry: 1fem (more details), 1.9 Å

PDB Description: crystallographic studies on complexes between retinoids and plasma retinol-binding protein
PDB Compounds: (A:) retinol binding protein

SCOPe Domain Sequences for d1fema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fema_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus) [TaxId: 9913]}
erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc
rllnldgtcadsysfvfardpsgfspevqkivrqrqeelclarqyrliphngycdgk

SCOPe Domain Coordinates for d1fema_:

Click to download the PDB-style file with coordinates for d1fema_.
(The format of our PDB-style files is described here.)

Timeline for d1fema_: