SCOPe 2.08: Domain d4xdpb_: 4xdp B:

Lineage for d4xdpb_ (4xdp B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins)
   Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
   Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811)

6. Protein automated matches [254635] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255633] (100 PDB entries)

8. Domain d4xdpb_: 4xdp B: [270827]
   automated match to d2xmla_
   complexed with cl, edo, fe, pg4, pge, trs, zn

Details for d4xdpb_

PDB Entry: 4xdp, 2.07 Å

PDB Description: crystal structure of human kdm4c catalytic domain bound to tris

PDB Compounds: (B:) lysine-specific demethylase 4c

SCOPe Domain Sequences for d4xdpb_:

Sequence; same for both SEQRES and ATOM records:

>d4xdpb_ b.82.2.14 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtk

Timeline for d4xdpb_:

• d4xdpb_ first appeared in SCOPe 2.05
  
• d4xdpb_ appears in SCOPe 2.07