SCOPe 2.08: Domain d3wyra1: 3wyr A:7-97

Lineage for d3wyra1 (3wyr A:7-97)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3wyra1: 3wyr A:7-97 [270800]
   automated match to d1nkra2
   complexed with nag

Details for d3wyra1

PDB Entry: 3wyr, 2.8 Å

PDB Description: crystal structure of killer cell immunoglobulin-like receptor 2dl4

PDB Compounds: (A:) Killer cell immunoglobulin-like receptor 2DL4

SCOPe Domain Sequences for d3wyra1:

Sequence; same for both SEQRES and ATOM records:

>d3wyra1 b.1.1.0 (A:7-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpfcsawpsavvpqgghvtlrchyrrgfniftlykkdgvpvpelynrifwnsflispvtp
ahagtyrcrgfhphsptewsapsnplvimvt

Timeline for d3wyra1:

• d3wyra1 first appeared in SCOPe 2.05
  
• d3wyra1 appears in SCOPe 2.07