SCOPe 2.08: Domain d3wyrb2: 3wyr B:98-195

Lineage for d3wyrb2 (3wyr B:98-195)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3wyrb2: 3wyr B:98-195 [270799]
   automated match to d1nkra2
   complexed with nag

Details for d3wyrb2

PDB Entry: 3wyr, 2.8 Å

PDB Description: crystal structure of killer cell immunoglobulin-like receptor 2dl4

PDB Compounds: (B:) Killer cell immunoglobulin-like receptor 2DL4

SCOPe Domain Sequences for d3wyrb2:

Sequence; same for both SEQRES and ATOM records:

>d3wyrb2 b.1.1.0 (B:98-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glyekpsltarpgptvrtgenvtlscssqssfdiyhlsregeahelrlpavpsingtfqa
dfplgpathgetyrcfgsfhgspyewsdasdplpvsvt

Timeline for d3wyrb2:

• d3wyrb2 first appeared in SCOPe 2.05
  
• d3wyrb2 appears in SCOPe 2.07