Lineage for d3wsob2 (3wso B:84-162)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752264Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 1752265Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 1752266Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 1752293Protein automated matches [226933] (1 species)
    not a true protein
  7. 1752294Species Human (Homo sapiens) [TaxId:9606] [225235] (3 PDB entries)
  8. 1752297Domain d3wsob2: 3wso B:84-162 [270795]
    Other proteins in same PDB: d3wsob1
    automated match to d4i6jc2

Details for d3wsob2

PDB Entry: 3wso (more details), 2.6 Å

PDB Description: crystal structure of the skp1-fbg3 complex
PDB Compounds: (B:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d3wsob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wsob2 a.157.1.1 (B:84-162) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
dfteeeeaqvrkenqwcee

SCOPe Domain Coordinates for d3wsob2:

Click to download the PDB-style file with coordinates for d3wsob2.
(The format of our PDB-style files is described here.)

Timeline for d3wsob2: