![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
![]() | Protein automated matches [190710] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187857] (25 PDB entries) |
![]() | Domain d3wsob1: 3wso B:1-69 [270794] Other proteins in same PDB: d3wsob2 automated match to d4i6jc1 |
PDB Entry: 3wso (more details), 2.6 Å
SCOPe Domain Sequences for d3wsob1:
Sequence, based on SEQRES records: (download)
>d3wsob1 d.42.1.0 (B:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq wcthhkddp
>d3wsob1 d.42.1.0 (B:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpsiklqssdgeifevdveiakqsvtiktmleddpvplpnvnaailkkviqwcthhkddp
Timeline for d3wsob1: