Lineage for d3wrib_ (3wri B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1743742Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1744216Protein automated matches [190068] (8 species)
    not a true protein
  7. 1744285Species Pseudomonas putida [TaxId:303] [186787] (12 PDB entries)
  8. 1744307Domain d3wrib_: 3wri B: [270790]
    automated match to d4kkyx_
    complexed with cam, hem

Details for d3wrib_

PDB Entry: 3wri (more details), 2.9 Å

PDB Description: crystal structure of p450cam
PDB Compounds: (B:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d3wrib_:

Sequence, based on SEQRES records: (download)

>d3wrib_ a.104.1.1 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkavhh

Sequence, based on observed residues (ATOM records): (download)

>d3wrib_ a.104.1.1 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipraydfiptsmdppeqrqfralanqvvgmpvvdklenriqe
lacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtf
aeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtv
vnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlk
kgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivtlke
wltripdfsiapgaqiqhksgivsgvqalplvwdpattkavhh

SCOPe Domain Coordinates for d3wrib_:

Click to download the PDB-style file with coordinates for d3wrib_.
(The format of our PDB-style files is described here.)

Timeline for d3wrib_:

  • d3wrib_ appears in periodic updates to SCOPe 2.05 starting on 2015-03-26
  • d3wrib_ is called d3wrib1 in SCOPe 2.06
  • d3wrib_ appears in the current release, SCOPe 2.07, called d3wrib1