Lineage for d3wria1 (3wri A:10-414)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005161Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2005162Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2005307Domain d3wria1: 3wri A:10-414 [270788]
    Other proteins in same PDB: d3wria2, d3wrib2
    automated match to d4kkyx_
    complexed with cam, hem

Details for d3wria1

PDB Entry: 3wri (more details), 2.9 Å

PDB Description: crystal structure of p450cam
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d3wria1:

Sequence, based on SEQRES records: (download)

>d3wria1 a.104.1.1 (A:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

Sequence, based on observed residues (ATOM records): (download)

>d3wria1 a.104.1.1 (A:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipraydfiptsmdppeqrqfralanqvvgmpvvdklenriqe
lacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtf
aeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtv
vnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlk
kgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivtlke
wltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d3wria1:

Click to download the PDB-style file with coordinates for d3wria1.
(The format of our PDB-style files is described here.)

Timeline for d3wria1:

  • d3wria1 first appeared in SCOPe 2.05, called d3wria_

View in 3D
Domains from same chain:
(mouse over for more information)
d3wria2