Lineage for d3wrkd1 (3wrk D:10-414)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331248Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2331249Species Pseudomonas putida [TaxId:303] [48267] (118 PDB entries)
    Uniprot P00183
  8. 2331397Domain d3wrkd1: 3wrk D:10-414 [270787]
    Other proteins in same PDB: d3wrka2, d3wrkd2
    automated match to d4kkyx_
    complexed with cam, hem

Details for d3wrkd1

PDB Entry: 3wrk (more details), 2.61 Å

PDB Description: crystal structure of p450cam
PDB Compounds: (D:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d3wrkd1:

Sequence, based on SEQRES records: (download)

>d3wrkd1 a.104.1.1 (D:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

Sequence, based on observed residues (ATOM records): (download)

>d3wrkd1 a.104.1.1 (D:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfiprpeqrqfralanqvvgmpvvdklenriqelacslieslrp
qgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtfaeakealydyl
ipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtvvnflsfsmefl
akspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlkkgdqillpqml
sglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivtlkewltripdfsia
pgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d3wrkd1:

Click to download the PDB-style file with coordinates for d3wrkd1.
(The format of our PDB-style files is described here.)

Timeline for d3wrkd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wrkd2