SCOPe 2.05: Domain d4wn9b_: 4wn9 B:

Lineage for d4wn9b_ (4wn9 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
   contains three domains of this fold; "Helical backbone" holds domains 2 and 3
   both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
   automatically mapped to Pfam PF00148

6. Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
   both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3

7. Species Clostridium pasteurianum [TaxId:1501] [81395] (3 PDB entries)

8. Domain d4wn9b_: 4wn9 B: [270779]
   Other proteins in same PDB: d4wn9a_, d4wn9c_
   automated match to d1miob_
   complexed with clf, fe, hca, ics, pro, xe

Details for d4wn9b_

PDB Entry: 4wn9, 1.9 Å

PDB Description: structure of the nitrogenase mofe protein from clostridium pasteurianum pressurized with xenon

PDB Compounds: (B:) nitrogenase molybdenum-iron protein beta chain

SCOPe Domain Sequences for d4wn9b_:

Sequence; same for both SEQRES and ATOM records:

>d4wn9b_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Clostridium pasteurianum [TaxId: 1501]}
mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf
kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis
qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg
padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls
lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli
dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae
agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy
ynpkvgykgairlveeitnvildkierecteedfevvr

Timeline for d4wn9b_:

• d4wn9b_ is new in SCOPe 2.05-stable
  
• d4wn9b_ appears in SCOPe 2.06
  
• d4wn9b_ appears in the current release, SCOPe 2.08