Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins) contains three domains of this fold; "Helical backbone" holds domains 2 and 3 both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3 automatically mapped to Pfam PF00148 |
Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species) |
Species Clostridium pasteurianum [TaxId:1501] [81396] (2 PDB entries) |
Domain d4wn9c_: 4wn9 C: [270778] Other proteins in same PDB: d4wn9b_, d4wn9d_ automated match to d1mioa_ complexed with clf, fe, hca, ics, pro, xe |
PDB Entry: 4wn9 (more details), 1.9 Å
SCOPe Domain Sequences for d4wn9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wn9c_ c.92.2.3 (C:) Nitrogenase iron-molybdenum protein, alpha chain {Clostridium pasteurianum [TaxId: 1501]} nlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvvm gpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnkl kdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsqs aghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltgd atyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakcf ddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvdsl vagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagvp lssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlhs ydyngpyagfrgvvnfghelvngiytpawkmitppwk
Timeline for d4wn9c_: