Lineage for d3wlla2 (3wll A:389-602)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465847Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families) (S)
    automatically mapped to Pfam PF01915
  5. 2465848Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain-like [52280] (3 proteins)
  6. 2465849Protein Beta-D-glucan exohydrolase, C-terminal domain [52281] (2 species)
    interdomain linker forms an additional, N-terminal strand
  7. 2465860Species Hordeum vulgare [TaxId:112509] [270748] (7 PDB entries)
  8. 2465865Domain d3wlla2: 3wll A:389-602 [270769]
    Other proteins in same PDB: d3wlla1
    automated match to d1iexa2
    complexed with edo, peg, pg4, pge

Details for d3wlla2

PDB Entry: 3wll (more details), 1.8 Å

PDB Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with peg400
PDB Compounds: (A:) beta-D-glucan exohydrolase isoenzyme ExoI

SCOPe Domain Sequences for d3wlla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wlla2 c.23.11.1 (A:389-602) Beta-D-glucan exohydrolase, C-terminal domain {Hordeum vulgare [TaxId: 112509]}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat

SCOPe Domain Coordinates for d3wlla2:

Click to download the PDB-style file with coordinates for d3wlla2.
(The format of our PDB-style files is described here.)

Timeline for d3wlla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wlla1