Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families) automatically mapped to Pfam PF01915 |
Family c.23.11.0: automated matches [270742] (1 protein) not a true family |
Protein automated matches [270743] (1 species) not a true protein |
Species Hordeum vulgare [TaxId:112509] [270744] (6 PDB entries) |
Domain d3wlta2: 3wlt A:389-602 [270766] Other proteins in same PDB: d3wlta1, d3wlta3 automated match to d1x38a2 complexed with gol, gs1, mgl, nag, so4 |
PDB Entry: 3wlt (more details), 1.98 Å
SCOPe Domain Sequences for d3wlta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wlta2 c.23.11.0 (A:389-602) automated matches {Hordeum vulgare [TaxId: 112509]} lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtieaqgdtgrttvgttil eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp rtwfksvdqlpmnvgdahydplfrlgyglttnat
Timeline for d3wlta2: