Lineage for d3wlta2 (3wlt A:389-602)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116632Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families) (S)
    automatically mapped to Pfam PF01915
  5. 2116672Family c.23.11.0: automated matches [270742] (1 protein)
    not a true family
  6. 2116673Protein automated matches [270743] (1 species)
    not a true protein
  7. 2116674Species Hordeum vulgare [TaxId:112509] [270744] (6 PDB entries)
  8. 2116678Domain d3wlta2: 3wlt A:389-602 [270766]
    Other proteins in same PDB: d3wlta1, d3wlta3
    automated match to d1x38a2
    complexed with gol, gs1, mgl, nag, so4

Details for d3wlta2

PDB Entry: 3wlt (more details), 1.98 Å

PDB Description: crystal structure analysis of plant exohydrolase
PDB Compounds: (A:) beta-D-glucan exohydrolase isoenzyme ExoI

SCOPe Domain Sequences for d3wlta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wlta2 c.23.11.0 (A:389-602) automated matches {Hordeum vulgare [TaxId: 112509]}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtieaqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat

SCOPe Domain Coordinates for d3wlta2:

Click to download the PDB-style file with coordinates for d3wlta2.
(The format of our PDB-style files is described here.)

Timeline for d3wlta2: