SCOPe 2.05: Domain d3wlha2: 3wlh A:389-602

Lineage for d3wlha2 (3wlh A:389-602)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families)
   automatically mapped to Pfam PF01915

5. Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain-like [52280] (3 proteins)

6. Protein Beta-D-glucan exohydrolase, C-terminal domain [52281] (2 species)
   interdomain linker forms an additional, N-terminal strand

7. Species Hordeum vulgare [TaxId:112509] [270748] (7 PDB entries)

8. Domain d3wlha2: 3wlh A:389-602 [270760]
   Other proteins in same PDB: d3wlha1
   automated match to d1iexa2
   complexed with bgc, gol, so4

Details for d3wlha2

PDB Entry: 3wlh, 1.65 Å

PDB Description: crystal structure analysis of plant exohydrolase

PDB Compounds: (A:) beta-D-glucan exohydrolase isoenzyme ExoI

SCOPe Domain Sequences for d3wlha2:

Sequence; same for both SEQRES and ATOM records:

>d3wlha2 c.23.11.1 (A:389-602) Beta-D-glucan exohydrolase, C-terminal domain {Hordeum vulgare [TaxId: 112509]}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat

Timeline for d3wlha2:

• d3wlha2 is new in SCOPe 2.05-stable
  
• d3wlha2 appears in SCOPe 2.06
  
• d3wlha2 appears in the current release, SCOPe 2.08