Lineage for d3wlja1 (3wlj A:1-388)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440705Family c.1.8.7: NagZ-like [51553] (4 proteins)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
    Some members have reversed beta strand compared to other members of fold
  6. 2440706Protein Beta-D-glucan exohydrolase, N-terminal domain [51554] (2 species)
    interdomain linker forms an additional, N-terminal strand
  7. 2440717Species Hordeum vulgare [TaxId:112509] [270746] (7 PDB entries)
  8. 2440720Domain d3wlja1: 3wlj A:1-388 [270756]
    Other proteins in same PDB: d3wlja2
    automated match to d1iexa1
    complexed with 3do, bgc, gol, so4

Details for d3wlja1

PDB Entry: 3wlj (more details), 1.67 Å

PDB Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 3-deoxy-glucose
PDB Compounds: (A:) beta-D-glucan exohydrolase isoenzyme ExoI

SCOPe Domain Sequences for d3wlja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wlja1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Hordeum vulgare [TaxId: 112509]}
dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
npyadpamaeqlgkqehrdlareaarks

SCOPe Domain Coordinates for d3wlja1:

Click to download the PDB-style file with coordinates for d3wlja1.
(The format of our PDB-style files is described here.)

Timeline for d3wlja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wlja2