SCOPe 2.06: Domain d3wlqa1: 3wlq A:1-388

Lineage for d3wlqa1 (3wlq A:1-388)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.7: NagZ-like [51553] (4 proteins)
   Pfam PF00933; Glycosyl hydrolase family 3 domain
   Some members have reversed beta strand compared to other members of fold

6. Protein automated matches [191056] (3 species)
   not a true protein

7. Species Hordeum vulgare [TaxId:112509] [270740] (6 PDB entries)

8. Domain d3wlqa1: 3wlq A:1-388 [270754]
   Other proteins in same PDB: d3wlqa2, d3wlqa3
   automated match to d1x38a1
   complexed with gol, nag

Details for d3wlqa1

PDB Entry: 3wlq, 1.65 Å

PDB Description: crystal structure analysis of plant exohydrolase

PDB Compounds: (A:) beta-D-glucan exohydrolase isoenzyme ExoI

SCOPe Domain Sequences for d3wlqa1:

Sequence; same for both SEQRES and ATOM records:

>d3wlqa1 c.1.8.7 (A:1-388) automated matches {Hordeum vulgare [TaxId: 112509]}
dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
pylvkrigeatalevratgiqyafapciavcrdprwgacyasysedrrivqsmtelipgl
qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
npyadpamaeqlgkqehrdlareaarks

Timeline for d3wlqa1:

• d3wlqa1 first appeared in SCOPe 2.05
  
• d3wlqa1 appears in SCOPe 2.07
  
• d3wlqa1 appears in the current release, SCOPe 2.08