Lineage for d1e0ud1 (1e0u D:70-167)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62010Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
  4. 62011Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 62012Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 62013Protein Pyruvate kinase (PK) [50802] (5 species)
  7. 62021Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)
  8. 62033Domain d1e0ud1: 1e0u D:70-167 [27075]
    Other proteins in same PDB: d1e0ua2, d1e0ua3, d1e0ub2, d1e0ub3, d1e0uc2, d1e0uc3, d1e0ud2, d1e0ud3

Details for d1e0ud1

PDB Entry: 1e0u (more details), 2.8 Å

PDB Description: structure r271l mutant of e. coli pyruvate kinase

SCOP Domain Sequences for d1e0ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ud1 b.58.1.1 (D:70-167) Pyruvate kinase (PK) {Escherichia coli}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

SCOP Domain Coordinates for d1e0ud1:

Click to download the PDB-style file with coordinates for d1e0ud1.
(The format of our PDB-style files is described here.)

Timeline for d1e0ud1: