Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) Heme-containing proteins |
Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
Protein Cytochrome c' [47180] (9 species) |
Species Alcaligenes sp. [TaxId:512] [47184] (13 PDB entries) |
Domain d4wgza_: 4wgz A: [270739] automated match to d1e83a_ complexed with hec |
PDB Entry: 4wgz (more details), 1.11 Å
SCOPe Domain Sequences for d4wgza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wgza_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes sp. [TaxId: 512]} efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach dayrkk
Timeline for d4wgza_: