SCOPe 2.08: Domain d4wgza_: 4wgz A:

Lineage for d4wgza_ (4wgz A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein Cytochrome c' [47180] (9 species)

7. Species Alcaligenes sp. [TaxId:512] [47184] (13 PDB entries)

8. Domain d4wgza_: 4wgz A: [270739]
   automated match to d1e83a_
   complexed with hec

Details for d4wgza_

PDB Entry: 4wgz, 1.11 Å

PDB Description: crystal structure of cytochrome c' from alcaligenes xylosoxidans ncimb 11015 at ph 6.0

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d4wgza_:

Sequence; same for both SEQRES and ATOM records:

>d4wgza_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes sp. [TaxId: 512]}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkk

Timeline for d4wgza_:

• d4wgza_ first appeared in SCOPe 2.05
  
• d4wgza_ appears in SCOPe 2.07