Lineage for d4wgya_ (4wgy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699788Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2699789Protein Cytochrome c' [47180] (9 species)
  7. 2699792Species Alcaligenes sp. [TaxId:512] [47184] (13 PDB entries)
  8. 2699799Domain d4wgya_: 4wgy A: [270737]
    automated match to d1e83a_
    complexed with hec

Details for d4wgya_

PDB Entry: 4wgy (more details), 1.48 Å

PDB Description: crystal structure of cytochrome c' from alcaligenes xylosoxidans ncimb 11015 at ph 10.4
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d4wgya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wgya_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes sp. [TaxId: 512]}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkk

SCOPe Domain Coordinates for d4wgya_:

Click to download the PDB-style file with coordinates for d4wgya_.
(The format of our PDB-style files is described here.)

Timeline for d4wgya_: