Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (7 species) not a true protein |
Species Jc polyomavirus [TaxId:10632] [270722] (7 PDB entries) |
Domain d4we0b_: 4we0 B: [270733] automated match to d4mbzj_ complexed with edo, gol; mutant |
PDB Entry: 4we0 (more details), 2.1 Å
SCOPe Domain Sequences for d4we0b_:
Sequence, based on SEQRES records: (download)
>d4we0b_ b.121.6.1 (B:) automated matches {Jc polyomavirus [TaxId: 10632]} vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva riplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhf fsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpd ptrnentryfgtltggenvmpvlhitntattvlldefgvgplckgdnlylsavdvcgmft nrsgsqqwrglsryfkvqlrkrrvk
>d4we0b_ b.121.6.1 (B:) automated matches {Jc polyomavirus [TaxId: 10632]} vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva riplpnlnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggea lelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent ryfgtltggenvmpvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq wrglsryfkvqlrkrrvk
Timeline for d4we0b_:
View in 3D Domains from other chains: (mouse over for more information) d4we0a_, d4we0c_, d4we0d_, d4we0e_ |