Lineage for d4wasa2 (4was A:161-349)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102559Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 2102560Protein 2,4-dienoyl-CoA reductase [89517] (1 species)
  7. 2102561Species Yeast (Candida tropicalis) [TaxId:5482] [89518] (6 PDB entries)
  8. 2102574Domain d4wasa2: 4was A:161-349 [270721]
    Other proteins in same PDB: d4wasa1, d4wasb1, d4wasc1
    automated match to d1gu7a2
    complexed with coo, nap

Details for d4wasa2

PDB Entry: 4was (more details), 1.7 Å

PDB Description: structure of the etr1p/nadp/crotonyl-coa complex
PDB Compounds: (A:) enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial

SCOPe Domain Sequences for d4wasa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wasa2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
ltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisv
irdrpnldevvaslkelgatqvitedqnnsrefgptikewikqsggeaklalncvggkss
tgiarklnnnglmltyggmsfqpvtiptslyifknftsagfwvtellknnkelktstlnq
iiawyeegk

SCOPe Domain Coordinates for d4wasa2:

Click to download the PDB-style file with coordinates for d4wasa2.
(The format of our PDB-style files is described here.)

Timeline for d4wasa2: