Lineage for d4wasb1 (4was B:23-160,B:350-386)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2055849Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2055850Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2055978Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2055979Protein 2,4-dienoyl-CoA reductase [89309] (1 species)
  7. 2055980Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (6 PDB entries)
  8. 2055994Domain d4wasb1: 4was B:23-160,B:350-386 [270718]
    Other proteins in same PDB: d4wasa2, d4wasb2, d4wasc2
    automated match to d1gu7a1
    complexed with coo, nap

Details for d4wasb1

PDB Entry: 4was (more details), 1.7 Å

PDB Description: structure of the etr1p/nadp/crotonyl-coa complex
PDB Compounds: (B:) enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial

SCOPe Domain Sequences for d4wasb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wasb1 b.35.1.2 (B:23-160,B:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

SCOPe Domain Coordinates for d4wasb1:

Click to download the PDB-style file with coordinates for d4wasb1.
(The format of our PDB-style files is described here.)

Timeline for d4wasb1: