SCOPe 2.08: Domain d4wasb1: 4was B:23-160,B:350-386

Lineage for d4wasb1 (4was B:23-160,B:350-386)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein 2,4-dienoyl-CoA reductase [89309] (1 species)

7. Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (6 PDB entries)

8. Domain d4wasb1: 4was B:23-160,B:350-386 [270718]
   Other proteins in same PDB: d4wasa2, d4wasb2, d4wasc2
   automated match to d1gu7a1
   complexed with coo, nap

Details for d4wasb1

PDB Entry: 4was, 1.7 Å

PDB Description: structure of the etr1p/nadp/crotonyl-coa complex

PDB Compounds: (B:) enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial

SCOPe Domain Sequences for d4wasb1:

Sequence; same for both SEQRES and ATOM records:

>d4wasb1 b.35.1.2 (B:23-160,B:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

Timeline for d4wasb1:

• d4wasb1 first appeared in SCOPe 2.05
  
• d4wasb1 appears in SCOPe 2.07