SCOPe 2.05: Domain d4wasc2: 4was C:161-349

Lineage for d4wasc2 (4was C:161-349)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
   N-terminal all-beta domain defines family

6. Protein 2,4-dienoyl-CoA reductase [89517] (1 species)

7. Species Yeast (Candida tropicalis) [TaxId:5482] [89518] (6 PDB entries)

8. Domain d4wasc2: 4was C:161-349 [270717]
   Other proteins in same PDB: d4wasa1, d4wasb1, d4wasc1
   automated match to d1gu7a2
   complexed with coo, nap

Details for d4wasc2

PDB Entry: 4was, 1.7 Å

PDB Description: structure of the etr1p/nadp/crotonyl-coa complex

PDB Compounds: (C:) enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial

SCOPe Domain Sequences for d4wasc2:

Sequence; same for both SEQRES and ATOM records:

>d4wasc2 c.2.1.1 (C:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
ltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisv
irdrpnldevvaslkelgatqvitedqnnsrefgptikewikqsggeaklalncvggkss
tgiarklnnnglmltyggmsfqpvtiptslyifknftsagfwvtellknnkelktstlnq
iiawyeegk

Timeline for d4wasc2:

• d4wasc2 is new in SCOPe 2.05-stable
  
• d4wasc2 appears in SCOPe 2.06
  
• d4wasc2 appears in the current release, SCOPe 2.08