![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein 2,4-dienoyl-CoA reductase [89309] (1 species) |
![]() | Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (6 PDB entries) |
![]() | Domain d4wasc1: 4was C:23-160,C:350-386 [270716] Other proteins in same PDB: d4wasa2, d4wasb2, d4wasc2 automated match to d1gu7a1 complexed with coo, nap |
PDB Entry: 4was (more details), 1.7 Å
SCOPe Domain Sequences for d4wasc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wasc1 b.35.1.2 (C:23-160,C:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity
Timeline for d4wasc1:
![]() Domains from other chains: (mouse over for more information) d4wasa1, d4wasa2, d4wasb1, d4wasb2 |