SCOPe 2.06: Domain d4v14a_: 4v14 A:

Lineage for d4v14a_ (4v14 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.0: automated matches [191580] (1 protein)
   not a true family

6. Protein automated matches [191036] (16 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [270713] (1 PDB entry)

8. Domain d4v14a_: 4v14 A: [270714]
   Other proteins in same PDB: d4v14b2
   automated match to d3gwyb_

Details for d4v14a_

PDB Entry: 4v14, 2.42 Å

PDB Description: structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae

PDB Compounds: (A:) Mutator mutT protein

SCOPe Domain Sequences for d4v14a_:

Sequence, based on SEQRES records:

>d4v14a_ d.113.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
krihivagiifnsdqseifitkrpdhlhkggfwefpggkveagesreqamvreleeeigi
tvteqqafqhfdfdytdkslsfdfmlvtafdgqphgregqqggwvkiadlanyrfpeand
pvvkqviaqf

Sequence, based on observed residues (ATOM records):

>d4v14a_ d.113.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
krihivagiifnsdqseifitkrpdhkggfwefpggkveagesreqamvreleeeigitv
teqqafqhfdfdslsfdfmlvtafdgqphgregqqggwvkiadlanyrfpeandpvvkqv
iaqf

Timeline for d4v14a_:

• d4v14a_ first appeared in SCOPe 2.05
  
• d4v14a_ appears in SCOPe 2.07
  
• d4v14a_ appears in the current release, SCOPe 2.08