![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
![]() | Protein automated matches [191036] (11 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [270713] (1 PDB entry) |
![]() | Domain d4v14a_: 4v14 A: [270714] automated match to d3gwyb_ |
PDB Entry: 4v14 (more details), 2.42 Å
SCOPe Domain Sequences for d4v14a_:
Sequence, based on SEQRES records: (download)
>d4v14a_ d.113.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]} krihivagiifnsdqseifitkrpdhlhkggfwefpggkveagesreqamvreleeeigi tvteqqafqhfdfdytdkslsfdfmlvtafdgqphgregqqggwvkiadlanyrfpeand pvvkqviaqf
>d4v14a_ d.113.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]} krihivagiifnsdqseifitkrpdhkggfwefpggkveagesreqamvreleeeigitv teqqafqhfdfdslsfdfmlvtafdgqphgregqqggwvkiadlanyrfpeandpvvkqv iaqf
Timeline for d4v14a_: