Lineage for d4v14a_ (4v14 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971952Species Vibrio cholerae [TaxId:666] [270713] (1 PDB entry)
  8. 2971953Domain d4v14a_: 4v14 A: [270714]
    Other proteins in same PDB: d4v14b2
    automated match to d3gwyb_

Details for d4v14a_

PDB Entry: 4v14 (more details), 2.42 Å

PDB Description: structure and function analysis of mutt from the psychrofile fish pathogen aliivibrio salmonicida and the mesophile vibrio cholerae
PDB Compounds: (A:) Mutator mutT protein

SCOPe Domain Sequences for d4v14a_:

Sequence, based on SEQRES records: (download)

>d4v14a_ d.113.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
krihivagiifnsdqseifitkrpdhlhkggfwefpggkveagesreqamvreleeeigi
tvteqqafqhfdfdytdkslsfdfmlvtafdgqphgregqqggwvkiadlanyrfpeand
pvvkqviaqf

Sequence, based on observed residues (ATOM records): (download)

>d4v14a_ d.113.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
krihivagiifnsdqseifitkrpdhkggfwefpggkveagesreqamvreleeeigitv
teqqafqhfdfdslsfdfmlvtafdgqphgregqqggwvkiadlanyrfpeandpvvkqv
iaqf

SCOPe Domain Coordinates for d4v14a_:

Click to download the PDB-style file with coordinates for d4v14a_.
(The format of our PDB-style files is described here.)

Timeline for d4v14a_: