| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
| Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
| Protein Protein phosphatase-1 (PP-1) [56311] (5 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [160869] (5 PDB entries) |
| Domain d4v0va_: 4v0v A: [270708] automated match to d2o8ga_ complexed with mn, na |
PDB Entry: 4v0v (more details), 1.61 Å
SCOPe Domain Sequences for d4v0va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v0va_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mlnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpae
Timeline for d4v0va_: