SCOP 1.57: Domain d1pkyc1: 1pky C:70-167

Lineage for d1pkyc1 (1pky C:70-167)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)

6. Protein Pyruvate kinase (PK) [50802] (5 species)

7. Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)

8. Domain d1pkyc1: 1pky C:70-167 [27070]
   Other proteins in same PDB: d1pkya2, d1pkya3, d1pkyb2, d1pkyb3, d1pkyc2, d1pkyc3, d1pkyd2, d1pkyd3

Details for d1pkyc1

PDB Entry: 1pky, 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state

SCOP Domain Sequences for d1pkyc1:

Sequence, based on SEQRES records:

>d1pkyc1 b.58.1.1 (C:70-167) Pyruvate kinase (PK) {Escherichia coli}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

Sequence, based on observed residues (ATOM records):

>d1pkyc1 b.58.1.1 (C:70-167) Pyruvate kinase (PK) {Escherichia coli}
peirmvavtyegfttdlsvgntvlvddgligmevtaiegnkvickvlnngdlgenkgvnl
pgvsial

Timeline for d1pkyc1:

• d1pkyc1 first appeared (with stable ids) in SCOP 1.55
  
• d1pkyc1 appears in SCOP 1.59
  
• d1pkyc1 appears in the current release, SCOPe 2.08