Lineage for d4ueqf_ (4ueq F:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953691Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1953692Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1953693Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 1953723Protein automated matches [190110] (7 species)
    not a true protein
  7. 1953737Species Desulfovibrio fructosivorans [TaxId:596151] [270655] (4 PDB entries)
  8. 1953743Domain d4ueqf_: 4ueq F: [270693]
    Other proteins in same PDB: d4ueqq_, d4ueqr_, d4ueqs_, d4ueqt_, d4uequ_, d4ueqv_
    automated match to d4urhc_
    complexed with ca, co3, f3s, fco, gol, h2s, mg, ni, sf4; mutant

Details for d4ueqf_

PDB Entry: 4ueq (more details), 1.7 Å

PDB Description: structure of the v74c large subunit mutant of d. fructosovorans nife- hydrogenase
PDB Compounds: (F:) Hydrogenase (NiFe) small subunit HydA

SCOPe Domain Sequences for d4ueqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ueqf_ e.19.1.1 (F:) automated matches {Desulfovibrio fructosivorans [TaxId: 596151]}
khrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhqa
legkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqka
kpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygelv
hdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqagh
pclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d4ueqf_:

Click to download the PDB-style file with coordinates for d4ueqf_.
(The format of our PDB-style files is described here.)

Timeline for d4ueqf_: