Lineage for d1pkyb1 (1pky B:70-167)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378454Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 378455Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 378456Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 378457Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 378465Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)
  8. 378471Domain d1pkyb1: 1pky B:70-167 [27069]
    Other proteins in same PDB: d1pkya2, d1pkya3, d1pkyb2, d1pkyb3, d1pkyc2, d1pkyc3, d1pkyd2, d1pkyd3

Details for d1pkyb1

PDB Entry: 1pky (more details), 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state

SCOP Domain Sequences for d1pkyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkyb1 b.58.1.1 (B:70-167) Pyruvate kinase (PK) {Escherichia coli}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

SCOP Domain Coordinates for d1pkyb1:

Click to download the PDB-style file with coordinates for d1pkyb1.
(The format of our PDB-style files is described here.)

Timeline for d1pkyb1: