Lineage for d1pkyb1 (1pky B:70-167)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16389Fold b.58: Pyruvate kinase beta-barrel domain [50799] (1 superfamily)
  4. 16390Superfamily b.58.1: Pyruvate kinase beta-barrel domain [50800] (1 family) (S)
  5. 16391Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 16392Protein Pyruvate kinase [50802] (5 species)
  7. 16400Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)
  8. 16406Domain d1pkyb1: 1pky B:70-167 [27069]
    Other proteins in same PDB: d1pkya2, d1pkya3, d1pkyb2, d1pkyb3, d1pkyc2, d1pkyc3, d1pkyd2, d1pkyd3

Details for d1pkyb1

PDB Entry: 1pky (more details), 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state

SCOP Domain Sequences for d1pkyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkyb1 b.58.1.1 (B:70-167) Pyruvate kinase {Escherichia coli}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

SCOP Domain Coordinates for d1pkyb1:

Click to download the PDB-style file with coordinates for d1pkyb1.
(The format of our PDB-style files is described here.)

Timeline for d1pkyb1: