Lineage for d4udoa_ (4udo A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143580Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2143581Protein automated matches [190944] (35 species)
    not a true protein
  7. 2143596Species Candidatus liberibacter [TaxId:34021] [270653] (3 PDB entries)
  8. 2143597Domain d4udoa_: 4udo A: [270671]
    automated match to d1xvla1
    complexed with act, gol, mn, so4

Details for d4udoa_

PDB Entry: 4udo (more details), 2.22 Å

PDB Description: structure of mn-bound periplasmic metal binding protein from candidatus liberibacter asiaticus
PDB Compounds: (A:) Periplasmic solute binding protein

SCOPe Domain Sequences for d4udoa_:

Sequence, based on SEQRES records: (download)

>d4udoa_ c.92.2.0 (A:) automated matches {Candidatus liberibacter [TaxId: 34021]}
kkvvlssfsiigditqniakdlvtvttlveagndshsyqvtsadaikiqnadlilcnglh
leetymkyftnlkkgtkiitvtdginpigvsedtsvdsepnphawmsltnamiyienirk
altaldpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylaedfg
fkslylwpinsdserspsmmrhainqmrshkikfifsestnsdqpakqvayetnasyggv
lyvdslskpdgpaptyldllrfsltkivdtlf

Sequence, based on observed residues (ATOM records): (download)

>d4udoa_ c.92.2.0 (A:) automated matches {Candidatus liberibacter [TaxId: 34021]}
kkvvlssfsiigditqniakdlvtvttlveagndshsyqvtsadaikiqnadlilcnglh
leetymkyftnlkkgtkiitvtdginpigvseddsepnphawmsltnamiyienirkalt
aldpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylaedfgfks
lylwpinsrspsmmrhainqmrshkikfifsestnsdqpakqvayetnasyggvlyvdsl
skpdgpaptyldllrfsltkivdtlf

SCOPe Domain Coordinates for d4udoa_:

Click to download the PDB-style file with coordinates for d4udoa_.
(The format of our PDB-style files is described here.)

Timeline for d4udoa_: