Lineage for d1e0td1 (1e0t D:70-167)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169754Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
  4. 169755Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 169756Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 169757Protein Pyruvate kinase (PK) [50802] (5 species)
  7. 169765Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)
  8. 169769Domain d1e0td1: 1e0t D:70-167 [27067]
    Other proteins in same PDB: d1e0ta2, d1e0ta3, d1e0tb2, d1e0tb3, d1e0tc2, d1e0tc3, d1e0td2, d1e0td3

Details for d1e0td1

PDB Entry: 1e0t (more details), 1.8 Å

PDB Description: r292d mutant of e. coli pyruvate kinase

SCOP Domain Sequences for d1e0td1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0td1 b.58.1.1 (D:70-167) Pyruvate kinase (PK) {Escherichia coli}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

SCOP Domain Coordinates for d1e0td1:

Click to download the PDB-style file with coordinates for d1e0td1.
(The format of our PDB-style files is described here.)

Timeline for d1e0td1: