Lineage for d1e0tb1 (1e0t B:70-167)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16389Fold b.58: Pyruvate kinase beta-barrel domain [50799] (1 superfamily)
  4. 16390Superfamily b.58.1: Pyruvate kinase beta-barrel domain [50800] (1 family) (S)
  5. 16391Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 16392Protein Pyruvate kinase [50802] (5 species)
  7. 16400Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)
  8. 16402Domain d1e0tb1: 1e0t B:70-167 [27065]
    Other proteins in same PDB: d1e0ta2, d1e0ta3, d1e0tb2, d1e0tb3, d1e0tc2, d1e0tc3, d1e0td2, d1e0td3

Details for d1e0tb1

PDB Entry: 1e0t (more details), 1.8 Å

PDB Description: r292d mutant of e. coli pyruvate kinase

SCOP Domain Sequences for d1e0tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0tb1 b.58.1.1 (B:70-167) Pyruvate kinase {Escherichia coli}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

SCOP Domain Coordinates for d1e0tb1:

Click to download the PDB-style file with coordinates for d1e0tb1.
(The format of our PDB-style files is described here.)

Timeline for d1e0tb1: