Lineage for d4ttgb3 (4ttg B:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830691Domain d4ttgb3: 4ttg B:334-625 [270639]
    Other proteins in same PDB: d4ttga1, d4ttga2, d4ttga4, d4ttga5, d4ttgb1, d4ttgb2, d4ttgb4, d4ttgb5, d4ttgc1, d4ttgc2, d4ttgc4, d4ttgc5, d4ttgd1, d4ttgd2, d4ttgd4, d4ttgd5
    automated match to d1jz7a5
    complexed with cl, dms, k, mg

Details for d4ttgb3

PDB Entry: 4ttg (more details), 1.6 Å

PDB Description: beta-galactosidase (e. coli) in the presence of potassium chloride.
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d4ttgb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ttgb3 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d4ttgb3:

Click to download the PDB-style file with coordinates for d4ttgb3.
(The format of our PDB-style files is described here.)

Timeline for d4ttgb3: