Lineage for d4ttgb1 (4ttg B:9-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383918Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2383919Protein beta-Galactosidase [49804] (3 species)
  7. 2383927Species Escherichia coli [TaxId:562] [49805] (45 PDB entries)
    Uniprot P00722
  8. 2383989Domain d4ttgb1: 4ttg B:9-219 [270637]
    Other proteins in same PDB: d4ttga2, d4ttga3, d4ttga4, d4ttga5, d4ttgb2, d4ttgb3, d4ttgb4, d4ttgb5, d4ttgc2, d4ttgc3, d4ttgc4, d4ttgc5, d4ttgd2, d4ttgd3, d4ttgd4, d4ttgd5
    automated match to d1jz7a3
    complexed with cl, dms, k, mg

Details for d4ttgb1

PDB Entry: 4ttg (more details), 1.6 Å

PDB Description: beta-galactosidase (e. coli) in the presence of potassium chloride.
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d4ttgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ttgb1 b.18.1.5 (B:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d4ttgb1:

Click to download the PDB-style file with coordinates for d4ttgb1.
(The format of our PDB-style files is described here.)

Timeline for d4ttgb1: