![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein beta-Galactosidase [49804] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
![]() | Domain d4ttgb1: 4ttg B:9-219 [270637] Other proteins in same PDB: d4ttga2, d4ttga3, d4ttga4, d4ttga5, d4ttgb2, d4ttgb3, d4ttgb4, d4ttgb5, d4ttgc2, d4ttgc3, d4ttgc4, d4ttgc5, d4ttgd2, d4ttgd3, d4ttgd4, d4ttgd5 automated match to d1jz7a3 complexed with cl, dms, k, mg |
PDB Entry: 4ttg (more details), 1.6 Å
SCOPe Domain Sequences for d4ttgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttgb1 b.18.1.5 (B:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d4ttgb1:
![]() Domains from same chain: (mouse over for more information) d4ttgb2, d4ttgb3, d4ttgb4, d4ttgb5 |