![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
![]() | Domain d4ttga2: 4ttg A:220-333 [270631] Other proteins in same PDB: d4ttga1, d4ttga3, d4ttga5, d4ttgb1, d4ttgb3, d4ttgb5, d4ttgc1, d4ttgc3, d4ttgc5, d4ttgd1, d4ttgd3, d4ttgd5 automated match to d1jz7a1 complexed with cl, dms, k, mg |
PDB Entry: 4ttg (more details), 1.6 Å
SCOPe Domain Sequences for d4ttga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttga2 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d4ttga2:
![]() Domains from same chain: (mouse over for more information) d4ttga1, d4ttga3, d4ttga4, d4ttga5 |