Lineage for d4u39f1 (4u39 F:13-202)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843871Family c.32.1.0: automated matches [227136] (1 protein)
    not a true family
  6. 1843872Protein automated matches [226838] (4 species)
    not a true protein
  7. 1843873Species Bacillus subtilis [TaxId:1423] [225338] (3 PDB entries)
  8. 1843881Domain d4u39f1: 4u39 F:13-202 [270627]
    Other proteins in same PDB: d4u39a2, d4u39b2, d4u39c2, d4u39d2, d4u39e2, d4u39f2, d4u39g2, d4u39i2
    automated match to d2vxya1
    complexed with po4

Details for d4u39f1

PDB Entry: 4u39 (more details), 3.19 Å

PDB Description: crystal structure of ftsz:mciz complex from bacillus subtilis
PDB Compounds: (F:) cell division protein ftsz

SCOPe Domain Sequences for d4u39f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u39f1 c.32.1.0 (F:13-202) automated matches {Bacillus subtilis [TaxId: 1423]}
sikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglgag
anpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgvv
trpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlrq
gvqgisdlia

SCOPe Domain Coordinates for d4u39f1:

Click to download the PDB-style file with coordinates for d4u39f1.
(The format of our PDB-style files is described here.)

Timeline for d4u39f1: