SCOPe 2.07: Domain d4u39b2: 4u39 B:211-314

Lineage for d4u39b2 (4u39 B:211-314)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.0: automated matches [227141] (1 protein)
   not a true family

6. Protein automated matches [226843] (8 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225339] (3 PDB entries)

8. Domain d4u39b2: 4u39 B:211-314 [270626]
   Other proteins in same PDB: d4u39a1, d4u39b1, d4u39c1, d4u39d1, d4u39e1, d4u39f1, d4u39g1, d4u39h1, d4u39i1
   automated match to d2vxya2
   complexed with po4

Details for d4u39b2

PDB Entry: 4u39, 3.19 Å

PDB Description: crystal structure of ftsz:mciz complex from bacillus subtilis

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d4u39b2:

Sequence, based on SEQRES records:

>d4u39b2 d.79.2.0 (B:211-314) automated matches {Bacillus subtilis [TaxId: 1423]}
fadvktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggtnl
slyevqeaadivasasdqdvnmifgsvinenlkdeivvtviatg

Sequence, based on observed residues (ATOM records):

>d4u39b2 d.79.2.0 (B:211-314) automated matches {Bacillus subtilis [TaxId: 1423]}
fadvktimsgsalmgigiataaeaakkaissplleaaidgaqgvlmnitggtnlslyevq
eaadivasasdqdvnmifgsvinenlkdeivvtviatg

Timeline for d4u39b2:

• d4u39b2 first appeared in SCOPe 2.05
  
• d4u39b2 appears in SCOPe 2.06
  
• d4u39b2 appears in the current release, SCOPe 2.08