| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
| Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
| Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
| Domain d4ttgc2: 4ttg C:220-333 [270621] Other proteins in same PDB: d4ttga1, d4ttga3, d4ttga5, d4ttgb1, d4ttgb3, d4ttgb5, d4ttgc1, d4ttgc3, d4ttgc5, d4ttgd1, d4ttgd3, d4ttgd5 automated match to d1jz7a1 complexed with cl, dms, k, mg |
PDB Entry: 4ttg (more details), 1.6 Å
SCOPe Domain Sequences for d4ttgc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttgc2 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d4ttgc2:
View in 3DDomains from same chain: (mouse over for more information) d4ttgc1, d4ttgc3, d4ttgc4, d4ttgc5 |