Lineage for d1a3xa1 (1a3x A:88-188)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804062Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2804063Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2804064Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2804065Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2804066Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50806] (2 PDB entries)
  8. 2804067Domain d1a3xa1: 1a3x A:88-188 [27062]
    Other proteins in same PDB: d1a3xa2, d1a3xa3, d1a3xb2, d1a3xb3
    complexed with k, mn, pga

Details for d1a3xa1

PDB Entry: 1a3x (more details), 3 Å

PDB Description: pyruvate kinase from saccharomyces cerevisiae complexed with pg, mn2+ and k+
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d1a3xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3xa1 b.58.1.1 (A:88-188) Pyruvate kinase (PK) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
peirtgtttndvdypippnhemifttddkyakacddkimyvdyknitkvisagriiyvdd
gvlsfqvlevvddktlkvkalnagkicshkgvnlpgtdvdl

SCOPe Domain Coordinates for d1a3xa1:

Click to download the PDB-style file with coordinates for d1a3xa1.
(The format of our PDB-style files is described here.)

Timeline for d1a3xa1: