![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
![]() | Protein beta-Galactosidase, domain 5 [49996] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [49997] (46 PDB entries) Uniprot P00722 |
![]() | Domain d4ttgd5: 4ttg D:731-1023 [270619] Other proteins in same PDB: d4ttga1, d4ttga2, d4ttga3, d4ttga4, d4ttgb1, d4ttgb2, d4ttgb3, d4ttgb4, d4ttgc1, d4ttgc2, d4ttgc3, d4ttgc4, d4ttgd1, d4ttgd2, d4ttgd3, d4ttgd4 automated match to d1jz7a4 complexed with cl, dms, k, mg |
PDB Entry: 4ttg (more details), 1.6 Å
SCOPe Domain Sequences for d4ttgd5:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttgd5 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d4ttgd5:
![]() Domains from same chain: (mouse over for more information) d4ttgd1, d4ttgd2, d4ttgd3, d4ttgd4 |