Lineage for d4ttgd4 (4ttg D:626-730)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762446Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
    Uniprot P00722
  8. 2762526Domain d4ttgd4: 4ttg D:626-730 [270618]
    Other proteins in same PDB: d4ttga1, d4ttga3, d4ttga5, d4ttgb1, d4ttgb3, d4ttgb5, d4ttgc1, d4ttgc3, d4ttgc5, d4ttgd1, d4ttgd3, d4ttgd5
    automated match to d1jz7a2
    complexed with cl, dms, k, mg

Details for d4ttgd4

PDB Entry: 4ttg (more details), 1.6 Å

PDB Description: beta-galactosidase (e. coli) in the presence of potassium chloride.
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d4ttgd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ttgd4 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d4ttgd4:

Click to download the PDB-style file with coordinates for d4ttgd4.
(The format of our PDB-style files is described here.)

Timeline for d4ttgd4: